McDonnell Genome Institute

Washington University

CircRNA

chr11|3702462|3702892|-|NUP98|ENST00000324932.11

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9331

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

4

7

Peptide

LLNLGGLLQSK

Amino Acids from 5' Exons

LVGYYNQNLQVELFFHQVSLCKNVVLPEQHLISHPHPLGLSLHPLLCSQCPAQPLRFRKQWVHVGNASLVKSLSPMARENSWTWPYSWDAHFVLVGAPTGLLLIVENSMALMNKIIRLPIPWSLDSCPIQLLN,WWVTTIKIYKWSFSFTKCLCARMSYSQSSIFNEYPIHILLVCPSTPDFCVHNAQPSPGSVENSGYTATRPSPSKVCHLWQGKTLDGHGPIHGTLISCWLGPQLDSCWRTAEWLSTRKSSDCRFHGVWIPAQSSSCT,GGLLQSKFTSGAFLSPSVSVQECRTPRAASLMNIPSTSSWSVPPPLTSVFTMPSPAPEVPLKTVGTRRQLGLVPREKSVTYGKGKLLMDMALFMGRSFRVGWGPNWTLANSGEQLNGSHELENHQIADSMEFGFLPNPVAVK

Amino Acids from 3' Exons

LVGYYNQNLQVELFFHQVSLCKNVVLPEQHLISHPHPLGLSLHPLLCSQCPAQPLRFRKQWVHVGNASLVKSLSPMARENSWTWPYSWDAHFVLVGAPTGLLLIVENSMALMNKIIRLPIPWSLDSCPIQLLN,WWVTTIKIYKWSFSFTKCLCARMSYSQSSIFNEYPIHILLVCPSTPDFCVHNAQPSPGSVENSGYTATRPSPSKVCHLWQGKTLDGHGPIHGTLISCWLGPQLDSCWRTAEWLSTRKSSDCRFHGVWIPAQSSSCT,GGLLQSKFTSGAFLSPSVSVQECRTPRAASLMNIPSTSSWSVPPPLTSVFTMPSPAPEVPLKTVGTRRQLGLVPREKSVTYGKGKLLMDMALFMGRSFRVGWGPNWTLANSGEQLNGSHELENHQIADSMEFGFLPNPVAVK