McDonnell Genome Institute

Washington University

CircRNA

chr11|3676508|3693375|-|NUP98|ENST00000324932.11

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9689

6

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

5

5

Peptide

LAQSGVAALR

Amino Acids from 5' Exons

VDCSGNDLEQLHIKVTSLCSRIEQIQCYSAKDRLAQS,WIAQVMTWSSYTSKLHCAVGSRFSVTVLKIAWLSQ,GLLRPGAVTHQSDFTVQSDRADSVLQCRSPGSV

Amino Acids from 3' Exons

VWQLSEKKQINVCSQLDWKRSLAIHLWYLLPPTASISRALSMYEEAFQ,CGSSQKRSKTCAPSWIGNAPWLSIFGICFHQQPPFLGRSACMKKHF,VAALRKEANKRVLPVGLETLPGYPSLVFASTNSLHFGAQHVRSIS