McDonnell Genome Institute

Washington University

CircRNA

chr11|35434511|35441693|-|PAMR1|ENST00000527605.5

Cancer

Type of Peptide

HCC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9858

26

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

6

3

Peptide

TIQSLQSLK

Amino Acids from 5' Exons

SAGKLRTSLLQRPKGCAGRGRQPSTGGPAGCMTAAYTRERGSSAAVPWMSALWWWLPTVLLTWGRSPSRQQTKLFWGNSTGMMTGMRRPSRAY,LRENEHHCSKDPRVALAVAGSHLQEDQRGARQPTQGSVVPSLQRCPGEAHCGGGCPLCYPGEGHHDQDSRPESCFGEILPGPGEDHPEPT,CGKIENITAPKTQGLRWPWQAAIYRRTSGVHDGSLHKGAWFLVCSGALVNERTVVVAAHCVTDLGKVTMIKTADLKVVLGKFYRDDDRDEKTIQSLQ

Amino Acids from 3' Exons

SLKKETAQTLGAQSMGTRKQGALGLSTDAMLKLAPWCLSFVTTPMFLVAMRKELASRMESGQGNSPSAK,PRKKLLRPWGPSQWVPENNRGPWAYQRTPCNWHRGVFLLQLLCSWQEKNLPAEWRVVRETAHLHK,LEERNCSDPGGPVNGYQKITGGPGLINGRHAKIGTVVSFFCNNSYVLSGNEKRTCQQNGEWSGKQPICIK