McDonnell Genome Institute

Washington University

CircRNA

chr11|34456010|34456817|+|CAT|ENST00000241052.4

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9553

10

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

6

32

Peptide

NPVNYFAEVEQIAFDPSNMPPGIEASPDKMLQTDQGIK

Amino Acids from 5' Exons

TDQGIKNLSVEDAARLSQEDPDYGIRDLFNAIATGKYPSWTFYIQVMTFNQAETFPFNPFDLTK,LTRASKTFLLKMRRDFPRKILTMASGIFLTPLPQESTPPGLFTSRSHLIRQKLFHLIHSISP,PGHQKPFCRCGETFPGRSLWHPGSFRHCHRKVPLLDFLHPGHDISGRNFSISIRSHQ

Amino Acids from 3' Exons

VWPHKDYPLIPVGKLVLNRNPVNYFAEVEQIAFDPSNMPPGIEASPDKMLQ,FGLTRTTLSSQLVNWSTGIQLITLLRLNRPSTQATCHLALRPVLTKCF,LASQGLPSHPSWTGLKPESSLLCGTDSLRPKQHATWHGQSQNAS