McDonnell Genome Institute

Washington University

CircRNA

chr11|33747129|33751607|-|FBXO3|ENST00000265651.7

Cancer

Type of Peptide

BRCA-HER2-enriched

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9657

2

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

13

Peptide

MLYQVASPSSETK

Amino Acids from 5' Exons

VNFQSSAQVGYMNTQAVPHSLQHQDTWKDIIPSIFFTLKTRSLMLPFPDSIWHVQHSGCLPD,ISNHQPRSGIIHKLYHILYNIRIHGRILYLPFSLLRQDLCCHSPIPYGMSNIQGVYSPI,EFPIISPGRVYEYTSCTTFSTTSGYMEGYYTFHFLYFKDKIFNVAIPRFHMACPTFRVSIARL

Amino Acids from 3' Exons

VLLLLTGLPLMSKMLYQVASPSSETKFS,CYFYLVYLLCQKCCIRWLPHHQRPNFQ,ATFTDWFTSYVKNVVSGGFPIIRDQIF