McDonnell Genome Institute

Washington University

CircRNA

chr11|32927961|32935435|+|QSER1|ENST00000399302.6

Cancer

Type of Peptide

BRCA-Basal-like

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

1

2

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

11

3

Peptide

ESSVMNFLSTAESR

Amino Acids from 5' Exons

VFLEYLILVTVPAVTLKSLQIFCLLLNPELLRLLLQELLSYHNSGLHPGRQ,SFWNIYCEQCQQHRVFSDEFSVYCIPNCSGCCFRNYSLTTIQGSILAD,LSGIFDTSVNSASSNTKESSVMNFLSTAESRTAQAAASGTTLLPQFRAPSWQT

Amino Acids from 3' Exons

ACIPQQQLSCLLLDLCQALEHFHHLSLLISIPPPSAIETLLPLHLWCFRIQLLTLHQMEFVIMTLCYKSRLPRELFQLLWHLSAWAVLYVTAYHLSLQHTAQLKSLHPIFYNLNLVCCLQHLGDPSRLLKPTVQLSLLVLLLPLKELFFENVVLLNTISGLQVPSQFRHNLVHSTPYIVIYQIQVLIFRKQPGSHLYPVAQLEIPLRATEDYNRRPPRSQWNLLSLTHLRFHHQGILLLLQKKAVLQNNHHQPRPLNLKVFLLCKHAIPNLYIIRVLYRAKHKFILQRSYQAFYQLVSPKITVYSHIMCHLLFIHRFIGPARLRNCHPCIKHLFLGHLRLLLKIRRLIIHLISKRYCLQLQMRITLLKQEICLQVSLKVTHLVTLRVYHQLARHRLAIHLNHKFCQLLVFQKAMLQGSPHQPLLFLILLPLGLRICQTLARPRIIFLCILPKMFRLKSHHLPSPRSFCLLSSHHLLHPLLIVRHYKITLPLTQSLMLKESLTQMCIHLQSKKMVFQCKSYRCCSHKHLLSHQPKGYLMEKLMLKNQLIRCQRQMTDILRVSEVIPVLKIKLLGLLCKHQKKKKVLLVQHNLTNKLAKSIMQLPLILRTQLIYRLHKGILKTSSNILSYLRCMSPRSRNSTIKLMLHLRFKFQIMLGMAIRHLFLIHRSFILPVIYKFFSSQYCRQVVKRHLYKHSVFKALNKYIPSFRWKVMLFKAMVIILSSNSILKILKLKWTSLSLQNHYNNIQQRAILVKQINMIQRISLFLLDRCVSQRQCFLVMKEIFYQMMISQLQQQLVELHLLIFPSQLQMKPCRLLKMVILNLIFSSHMSGMLQILTLQLQESHRIMILPMEIRLLTFHQYLPFSQKLLINSTLKHLVKIYQLKLQQWLDQVMKSRSKVLAHSRNSLLPILNLKKTVKLLLIVHIITETKSLFLVVEVVERMLHQRVNLPGVTTVVCQTQLGVHLHCWPWPNLGMQSVSRLKKKTKICILTFKRKELKEKGKLKRKTTVIRNSKDLPKANARIQGEQIFTYRILLLPQKAAMMVISIKKKDRRSKRWRKNNQKSKQDLLLLSIFNPGPSSSFPLLLYECLTGLDGQGPRWFVHFVPHHFPSLHLQHPHLCLKLAVTVHQIKLIMNLKTWNIYLHFLLMKMILDIVKMLIKASLLPLLWMLLLIKRRKQ,HAFLSSNAVCYWTFAKHWNTSTISLCLSASHHLQQKLCYHFTFGASGFNFHYIKWNFKSSPFATNQDFPGNCSNCFGIAPGQFCIKQHTTSVFNIPLSSRVCTPSFTTSIFVAFSTWGIPADSSSLQFNSLYFYCFHKSSSSRMCYTPSAAFRYPVNSGTTDWFTALLTLSIKFKCSFSGNNQAVIFILPNWRFHSGEQRRITTEDLPGLSGTCSVLLICDSIIRVSSFYYKNKKLFYRTTTDINQDPTSKYNSSCANTKLFQTFTSEFCNIGPSTNLFYSAATKPFISSVPKLRFSTATCAIYCSFTGLVQQGEIATLVNIDFFWVISDCNSKSDALFISARGIVFSYKELPCSNKRSVFSKSVSKLLIWSLSGFITSPDTGLFISITSFVSCSFRKLCFRGVPNINSPFSFLFFCLSGSEFARLPDPELYFYAFFPKCSDSRVIISPVPEVFACCPVIIFCILYSLSDITKHNFPPKVLCKKALRCVSIFKARRWFSNARVTGVAATSISVINPKAIWRNCSRINLGVKGRQIFSECNQKFPSRSSYWGCSASIKKRRKCCWFSDTTPTNWPSQCSYPSELNFNTDSTNKVEYRLKAATSSHTGAVQGPGTARSNNCFISDSNSKSCFRAWPSGISSYTGPFRFCLFTNSSAVNTAGRFRSSKGIFTSTACSKPSTNSTSLPSDGRSCYSKQWSFSAATPSSKFSYENGPLVFKTITTTSNNKGPFNKSTFKESVCFSWIDVFPRGSASKKYFIKCRYLSSYSSSLWSYTYFFQVNFKNHAGCRWFISFSAVIRCQACDFRFLYDSYSRKATEYKYFLKWKSGYCEPFTSTCPSVKNDSSTAHNTWSKYTNSNFSSGWTKSSPGAKFWPIQETVCYQSIRRQSSCYIKQKPRVCFKYKWRECYIREIYLRGRQWCVNEPSECTCTVGHGPIWGCSQCQDRRKPRFNAFPSKEKSRKRASRGRQQSETAEKTCPRQTPESKGNRYLLTVYSSFLRKLPWLSASRKNETEDQRGGGKTTRSQNRIYCFFLRFSEIRAQAAVFHSCCTNAQDTARDPDGSYILSPTTSQAFIYNTHTFSVNWRQSIRSTKLGTFIFIFFRSWISRCLKRLYSLNYFGCYFKEEN,MHSSAATELFATGPLPSTGTLPPSLSAYQHPTTFSNRNFATTSPLVLQDSTFNTTSNGILSHHDPLLQIKTSQGTVPTALAFERLGSSVLSNSIPPQSSTYRSAQESAPHLLQPQFSLLPSALGGSQQTPQAYSSTLFTSSTASIERALLRECSVIKHHQRPSGTQSIQAQLTGSQHSLHSYLSNSSVVNFQETTRQSSLSCSPIGDSTQVSNGGLQQKTSQVSVELAQSYSSAIPSSGYPPSTTKIKSCSTEQPLTSTKTPKPQSIIPPVQTLSYSKPLHNQSSVISGQAQIYSTAQLPSLLSVSQSQNYGLVQPHNVPSIVHSQVYRSSKVEKLPPLYKTLTFSGSSQTVTPENQTLNYSSNQQEVLSSVTNENYPAQTRDLSSVSQSQSYSSGHSQGLSPVSQTQVSYSSQSQVLSVVSLSESYASGESLTLTAPSLSYSSASRAQNLPDSSPTQNYISMHSSQNVQTQESSSPQSQKFLPAVQSSSFASSTHCQTLQNNITSPDPKSYAERKLDSDVYPSSKQEDGFPMQELQVLQPQASLESSTQRLSDGEINAQESTYKVSKADDRYSQSVIRSNSRLEDQVIGVALQASKKEESVVGSVTQLNQQIGQVNNAATLDLKNSTNLIQTPQIRLNTKDLKQQHPLILKVHESKVQEQHDQIINASSQIQIPNHALGHGHQASLPNTQVLLDSACDLQILQQSILQAGLGQVKASLQAQRVQSPQQIVHPFLQMEGHVIQSNGDHSQQQLHPQNSEVMKMDLSESSKPLQQHLTTKGHFSETNQHDSKNQFVSLGSMCFPEAVLLSDERNILSNVDDILAATAAACGVTPTDFSKSTSNETMQAVEDGDSKSHFQQSLDVRHVTSDFNSMTATVGKPQNINDTSLNGNQVTVNLSPVPALQSKMTLDQQHIETPGQNIPTKVTSAVVGPSHEVQEQSSGPFKKQSATNLESEEDSEAPVDSTLNNNRNQEFVSSSRSISGENATSESEFTLGGDDSGVSMNPARSALALLAMAQSGDAVSVKIEEENQDLMHFNLQKKRAKGKGQVKEEDNSNQKQLKRPAQGKRQNPRGTDIYLPYTPPSSESCHDGYQHQEKMRQKIKEVEEKQPEVKTGFIASFLDFLKSGPKQQFSTLAVRMPNRTRRPGTQMVRTFCPPPLPKPSSTTPTPLVSETGGNSPSDKVDNELKNLEHLSSFSSDEDDPGYSQDAYKSVSTPLTTLDATSDKKKKT