McDonnell Genome Institute

Washington University

CircRNA

chr11|31539661|31650221|+|ELP4|ENST00000350638.9

Cancer

Type of Peptide

HCC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9269

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

2

6

Peptide

KLFTIERR

Amino Acids from 5' Exons

RRINIIFTHLCSSSISWQKELSMGILCWLHLLKRILPTFY,GGIYLLTFALQVFPGRRNCQWAYFVGCICRGSCQHFT,EDKYNIYSPLLFKYFLAEGIVNGHTLLVASAKEDPANILQ

Amino Acids from 3' Exons

DFIYGRFLGLITSVMNQMSKTLLNKGSYSPL,IDSYTADSSALDLIRCQRLSFIKKEAIHH,LIHIRQIPRLNNLICDESDVKDLAFKLKRKLFTIE