McDonnell Genome Institute

Washington University

CircRNA

chr11|2964679|2972279|-|NAP1L4|ENST00000448187.5

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9111

8

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

7

15

Peptide

LTLDSLWHEDVVFLTPFFSLPK

Amino Acids from 5' Exons

EYDEPILKHLQDIKVKFSDPGQPM,NMMNQSNTCRILKNFLTLDSL,ITNLETPAGYSEIFPWTAY

Amino Acids from 3' Exons

AGCCISYSLFFTSSKKKNCIETTSGEMCSHRSQVLRGTLGKKVCSAIPASLQ,HEDVVFLTPFFSLPKAVKRRINALKQLQVRCAHIEAKFYEEVHDLERKYAALYQPLFDK,MRMLYFLLPFLVYLKQKEELMHNNFRDVLTKPSSMKRYMTWKESMQRYTSLSLT