McDonnell Genome Institute

Washington University

CircRNA

chr11|2527927|2572986|+|KCNQ1|ENST00000155840.9

Cancer

Type of Peptide

OSCC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9515

8

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

12

14

Peptide

VEFGSYADALWWGVLPHRPGLPHLQR

Amino Acids from 5' Exons

LPHRPGLPHLQRAVHHRAVCRPGHGDSLLD,FLIVLVCLIFSVLSTIEQYAALATGTLFWM,SSSSWSASSSACCPPSSSMPPWPRGLSSG

Amino Acids from 3' Exons

ELITTLYIGFLGLIFSSYFVYLAEKDAVNESGRVEFGSYADALWWGV,SPPCTSASWASSSPRTLCTWLRRTRTSQAAWSSAATQMRCGGG,ADNHPVHRLPGPHLLLVLCVPGEGRGERVRPRGVRQLRRCAVVGG