McDonnell Genome Institute

Washington University

CircRNA

chr11|20847582|21229454|+|NELL1|ENST00000298925.9

Cancer

Type of Peptide

LUAD

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9952

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

11

4

Peptide

DHLQSYFELESSGLR

Amino Acids from 5' Exons

LFTGEQWPEGDSVSLHTQWEAKDRGTSLPHGRWTMAQGCTVSRLSSPAPCRLQ,YFELESSGLRDEIRYHYIHNGKPRTEALPYRMADGQWHKVALSVSASHLLLHVDCN,ILNWRAVAGMRFGITTYTMGSQGQRHFLTAWQMDNGTRLHCQLAPLISCSMSTVT

Amino Acids from 3' Exons

NTMNVAAASTTVMRMPSAPTLSRDTAAPANRATWGTGPSAE,TRMWQRPAQLECHLHQHCPGTQLHLQTGLRGERDHLQ,HDECGSGQHNCDENAICTNTVQGHSCTCKPGYVGNGTICR