McDonnell Genome Institute

Washington University

CircRNA

chr11|19879868|19880127|+|NAV2|ENST00000349880.8

Cancer

Type of Peptide

LUAD

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9995

5

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

1

7

Peptide

AQAEMQSR

Amino Acids from 5' Exons

RSGMETSRPFASSSASPDTSSSSSSPRSSTSPHLCRPPYPRWPGPPPSARLAPLSSRCQSLPKPRASLTSQRHISSQKHKLKCSP,DQEWKPQGHSRPLLQPLPIQAAAAAAPEAAPLLTSAARRIPGGRGPLPVPGWHPSAAGASHSPSPVPASPASATSAVKSTSNAVQ,IRNGNLKAILGLFFSLSRYKQQQQQPQKQHLSSPLPPAVSQVAGAPSQCQAGTPQQQVPVTPQAPCQPHQPAPHQQSKAQAEMQS

Amino Acids from 3' Exons

RSGMETSRPFASSSASPDTSSSSSSPRSSTSPHLCRPPYPRWPGPPPSARLAPLSSRCQSLPKPRASLTSQRHISSQKHKLKCSP,DQEWKPQGHSRPLLQPLPIQAAAAAAPEAAPLLTSAARRIPGGRGPLPVPGWHPSAAGASHSPSPVPASPASATSAVKSTSNAVQ,IRNGNLKAILGLFFSLSRYKQQQQQPQKQHLSSPLPPAVSQVAGAPSQCQAGTPQQQVPVTPQAPCQPHQPAPHQQSKAQAEMQS