McDonnell Genome Institute

Washington University

CircRNA

chr11|18614562|18616989|-|SPTY2D1|ENST00000336349.5

Cancer

Type of Peptide

OV

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9583

50

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

10

2

Peptide

QMENYLQLCPKR

Amino Acids from 5' Exons

PRRKGEKRNKSELSSNMTRKQELWPRGQRIISMVTMGFLLRKSQRRGRQQKAIPAKEPTESMKWKKRMNSSSTITQSQSRSMRKSKNLPKLKANQRSPLKVPHHPTSLIYSGWLRKSSLNQWKSRRNQKSDLPQKNLGSENSLNESIGEKNLRQMENYLQLCPKRHPLRKKVWAQNLAKVLETGILLPKECPFLMLRRNQDPAWPMRNTSLCLHPNPCQERGSRQDLAIAPNPHFVRATTNLFLMELESLIPAPLHQVSQRLLLAGLRNLLLSTKPKNLCPILAIPGLGPWSPHTIRLRVQVSGSQAAALAQPLGSPAQGLLDPQLVLALCLGARMAAPAQDLSDQSVGPRSQPMTQIPLGGQSVVHVALDNLQAAQVALGDPSVVQLVLQDPWAALVALAGLAVHMNFDDQVAWAPRGGLSVALGDPVAQFQLDGLSVIQSQEDQAAWDLGKQLVAQVPLSLSALLSPKQFLPRISLAGPAMDRMESLPYLATELPK,LRGEKEKRGTSEKANAQTQESKSYGQEDKGFPWLQWDSYGKVKEEAGNRKPYQPRNRPRVNGRREIPRVQSRRVRAGVGRARTSQSKQTKGPPKCPTTHELHFTQAGEKAVTSGNQGSEEIRRATYDRRRTGARIPTKAEKKTDRWKTTSNCVQKGTLSERKCGHKTQRFWRQASFFQRNAPSSCEEIKTQHGQETPRFVFIQIHARREDQGRIWQLPTLTSGPRQTCFWSWKASFQHLFTKCPKDFCQDSEICCAQSQKISVPSPFQAWAHGHPTQGESRCQAARQQLLSPWAAQHRGCSTHSFWPCAAPEWQLQLRTAINQWVQEANQLKSLADSQWYMWPWTTCKQLRWPWATHQWFSFCKTLGQLSWPWPACEQSTTSTTSEWLGPPGAVCQWPWEIHKWLNSSWTDCQFSPRKTSEQLGTWANSLRSHYKAVHCCLRNNFFQEYHPVQQWTDEWNEASPIWLQSCP,LEEKRRKEELVKKRIELKHDKKARAMAKRTKDNFHGYNGIPIEEKSKKRQATESHTSQGTDREYEMEEENEFLEYNHAESEQEYEEEQEPPKVESKPKVPLKSAPPPMNFTDLLRLAEKKQFEPVEIKVVKKSEERPMTAEELREREFLERKHRRKKLETDGKLPPTVSKKAPSQKESVGTKLSKGSGDRHPSSKGMPLPHAEKKSRPSMANEKHLALSSSKSMPGERIKAGSGNSSQPSLREGHDKPVFNGAGKPHSSTSSPSVPKTSASRTQKSAVEHKAKKSLSHPSHSRPGPMVTPHNKAKSPGVRQPGSSSSSAPGQPSTGVARPTVSSGPVPRRQNGSSSSGPERSISGSKKPTNDSNPSRRTVSGTCGPGQPASSSGGPGRPISGSVSSARPLGSSRGPGRPVSSPHELRRPVSGLGPPGRSVSGPGRSISGSIPAGRTVSNSVPGRPVSSLGPGQTVSSSGPTIKPKCTVVSETISSKNIISRSSNGQMNGMKPPLSGYRAAQ

Amino Acids from 3' Exons

KRYSLAVGPPKKDPKVKGVQSAAVQAFLKRKEEELRRK,KGIVWQWGLQKKTQKLKVSNQQLYKLFLKGKKRSDEK,KVFGSGASKKRPKSRCPISSCTSFSKERRGAETK