McDonnell Genome Institute

Washington University

CircRNA

chr11|18566346|18570377|-|UEVLD|ENST00000300038.7

Cancer

Type of Peptide

OV

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.904

6

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

4

8

Peptide

ITEGNTYNIPIR

Amino Acids from 5' Exons

PKSVIVGLIKEMIAKFQEELPMYSLSSSDEARQVDLLAYIAKITE,LNLSLLDLKKLPSFKRNFPCILYHHLMRHGRTCPILQKSLK,ICHCWINRNDCQVSRGTSHVFSIIIGTAGRLASLYCKNH

Amino Acids from 3' Exons

VIHITYQFVSGFWILTLSLPLFASSQLQIWESSENMWMLKAEYICPISKTGA,YIHTNSFLDFGFSPFRSPYLLLEANCKYGNLSRKTCGCSRQNIFALSPKLEP,NTYNIPIRFWILDSHPFAPPICFLKPTANMGILVGKHVDAQGRIYLPYLQNWSH