McDonnell Genome Institute

Washington University

CircRNA

chr11|18347587|18360707|+|GTF2H1|ENST00000265963.8

Cancer

Type of Peptide

OV

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9838

2

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

14

7

Peptide

RQYLSTNGYGISSVPSASNSK

Amino Acids from 5' Exons

GYGISSVPSASNSKSIKENSNAAIIKRFNHHSAMVLAAGLRK,AMAFPLCHLLPILNPKRIVMLPSSRDLTITVPWSWQLDSEN,LWHFLCAICFQFIHKRECCHHQEIPSQCHGPGSWTQKT

Amino Acids from 3' Exons

VVKMKSNLERFQVTKLCPFQEKIRRQYLSTN,KKVIWNDSKLRSSVHSKKRFGDSIAQ,SENEKFGTIPSYEALSIPRKDSETVFKHK