McDonnell Genome Institute

Washington University

CircRNA

chr11|17771664|17772598|+|KCNC1|ENST00000265969.6

Cancer

Type of Peptide

LUAD

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9996

45

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

8

Peptide

LCGLVHLR

Amino Acids from 5' Exons

YVAFASLFFILVSITTFCLETHERFNPIVNKTEIENVRNGTQVRYYREAETEAFLTYIEGVCVVWFTFEFLMRVIFCPNKVEFIKNSLNIIDFVAILPFYLEVGLSGLSSKAAKDVLGFLRVVRFVRILRIFKLTRHFVGLRVLGHTLRASTNEFLLLIIFLALGVLIFATMIYYAERIGAQPNDPSASEHTHFKNIPIGFWWAVVTMTTLGYGDMYPQTWSGMLVGALCALAGVLTIAMPVPVIVNNFGMYYSLAMAKQKLPKKKKKHIPRPPQLGSPNYCKSVVNSPHHSTQSDTCPLAQEEILEINRA,MWPSLPSSSSWSPSPPSAWRPTSASTPSTRRRSRTFAMARKCATTGRPRRRPSLPTSRASVWSGSPSSSSCVSSSAPTRSSSRTRSTSLTLWPSCPSTWRWGAACPPRQPRTCWASCASSASCASCASLSPATLWACGSWATRSEPAPTSSCCSSSSWPWACSSPPSTTPRGGHSPMTPAPVSTRTLRTSPSASGGPWSPRPWAMETCTRRRGPACWWGLCVRWRACSPSPCPCPSSTISGCITPPWLSRNYQRKKRSIFRGHRSWDLPIIVNLSTLHTTVLRVTHVRWPRKKFKLTEQ,CGLRFPLLHPGLHHHLLPGDPRALQPHREQDGDRERSQWHASALLPGGRDGGLPYLHRGRLCGLVHLRVPHACHLLPQQGRVHQELAQHHLCGHPALLPGGGAERPVLQGSQGRAGLPARRPLRAHLAHLADPPLCGPAGPGPHAPSQHQRVPAAHHLPGLGRADLRHHDLLRREDRGTAQPQRQAHALEHPHRLLVGRGHHDDPGLWRHVPADVVRHAGGGSVCAGGRAHHRHARARHREQFRDVLLLSHGAETTKEKKEAYSAATAAGISQLLICRKLSTPQYSEHMSAGPGRNFRNQS

Amino Acids from 3' Exons

YVAFASLFFILVSITTFCLETHERFNPIVNKTEIENVRNGTQVRYYREAETEAFLTYIEGVCVVWFTFEFLMRVIFCPNKVEFIKNSLNIIDFVAILPFYLEVGLSGLSSKAAKDVLGFLRVVRFVRILRIFKLTRHFVGLRVLGHTLRASTNEFLLLIIFLALGVLIFATMIYYAERIGAQPNDPSASEHTHFKNIPIGFWWAVVTMTTLGYGDMYPQTWSGMLVGALCALAGVLTIAMPVPVIVNNFGMYYSLAMAKQKLPKKKKKHIPRPPQLGSPNYCKSVVNSPHHSTQSDTCPLAQEEILEINRA,MWPSLPSSSSWSPSPPSAWRPTSASTPSTRRRSRTFAMARKCATTGRPRRRPSLPTSRASVWSGSPSSSSCVSSSAPTRSSSRTRSTSLTLWPSCPSTWRWGAACPPRQPRTCWASCASSASCASCASLSPATLWACGSWATRSEPAPTSSCCSSSSWPWACSSPPSTTPRGGHSPMTPAPVSTRTLRTSPSASGGPWSPRPWAMETCTRRRGPACWWGLCVRWRACSPSPCPCPSSTISGCITPPWLSRNYQRKKRSIFRGHRSWDLPIIVNLSTLHTTVLRVTHVRWPRKKFKLTEQ,CGLRFPLLHPGLHHHLLPGDPRALQPHREQDGDRERSQWHASALLPGGRDGGLPYLHRGRLCGLVHLRVPHACHLLPQQGRVHQELAQHHLCGHPALLPGGGAERPVLQGSQGRAGLPARRPLRAHLAHLADPPLCGPAGPGPHAPSQHQRVPAAHHLPGLGRADLRHHDLLRREDRGTAQPQRQAHALEHPHRLLVGRGHHDDPGLWRHVPADVVRHAGGGSVCAGGRAHHRHARARHREQFRDVLLLSHGAETTKEKKEAYSAATAAGISQLLICRKLSTPQYSEHMSAGPGRNFRNQS