McDonnell Genome Institute

Washington University

CircRNA

chr11|1753993|1754131|-|CTSD|ENST00000433655.5

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9518

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

9

11

Peptide

AIGAVPLIQGEVASGLTLCK

Amino Acids from 5' Exons

VASGLTLCKEGCEAIVDTGTSLMVGPVDEVRELQKAIGAVPLIQGE,WPAGPCARRAVRPLWTQALPSWWARWMRCASCRRPSGPCRFRA,GQRADPVQGGLGHCGHRHFPHGGPGGGARAAEGHRGRAADSGR

Amino Acids from 3' Exons

VASGLTLCKEGCEAIVDTGTSLMVGPVDEVRELQKAIGAVPLIQGE,WPAGPCARRAVRPLWTQALPSWWARWMRCASCRRPSGPCRFRA,GQRADPVQGGLGHCGHRHFPHGGPGGGARAAEGHRGRAADSGR