McDonnell Genome Institute

Washington University

CircRNA

chr11|16786228|16795018|-|PLEKHA7|ENST00000531066.5

Cancer

Type of Peptide

LUAD

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

1

5

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

20

2

Peptide

VQAMPVTELDLEPQDYDLDISR

Amino Acids from 5' Exons

WKREQDFDLQLLERVVQGEKKDKEENGWLKVQAMPVTELDLEPQDYDLDISRE,GSVSRTLTCSCWNGSCKGKKRTRRRMAGKCRPCLSLSWTWSLKTMTWTSAE,EAAGLPAVAGTGRARGKKGQGGEWLVESAGHACHVGPGASRLLGHQQR

Amino Acids from 3' Exons

EKSQIQKDLWRIEDVTAGLSANKENFRILVESVKNP,RNRRYRKIYGELKMSLQAVQIKRTSEFWSQKIR,EIADTERSMENRCHCRPECKRELQNSSGVSKKS