McDonnell Genome Institute

Washington University

CircRNA

chr11|16782753|16783833|-|PLEKHA7|ENST00000529049.1

Cancer

Type of Peptide

OV

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

1

2

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

18

Peptide

YVELDPEEPPSLEELQAR

Amino Acids from 5' Exons

HVQPTADLRPGPEQCGPGLAAAGAGAHHQHLLRPGLRGLPAQAGG,MCNLQPTSGQDQNSVADLDLQLQEQERIINISYALASEASQRSKQVA,CATYSRPQARTRTVWLTWTCSCRSRSASSTSPTPWPPRPPSVASRWQ

Amino Acids from 3' Exons

LSKPEKVSIPERYVELDPEEPPSLEELQARYRKAEKIRNILARS,CPNQRRCQSLSATWSIPKSHPALRSCRRGTAKPRRSATSSPGQ,VQTREGVNPALRGARSRRATQPGAAGAVPQSREDPQHPRPVK