McDonnell Genome Institute

Washington University

CircRNA

chr11|14474494|14479714|-|COPB1|ENST00000249923.7

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9971

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

2

21

Peptide

QNLMEFLSDNNEAAAADVLEFVR

Amino Acids from 5' Exons

TSLERIPSGWRFLCCCLPCHNSDQDCIALCSFGSGEEKAK,PPLRGFLLDGDFFVAASLATTLTKIALRYVALVQEKKKQN,LPEDSFWMEISLLLPPLPQLPRLHCAMLWFRRRKSK

Amino Acids from 3' Exons

LMEFLSDNNEAAAADVLEFVREAIQRFDNLRMLIVEKMLEVFHAIKSV,WNFSVTTTKQQLLMSWSLFVKPFSALITECLLLRRCLKSFMLLNLS,NGISQQQRSSSCCLGVCSSHSALPENAYCEDASLSCYICQ