McDonnell Genome Institute

Washington University

CircRNA

chr11|13694758|13708079|+|FAR1|ENST00000354817.7

Cancer

Type of Peptide

OV

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9433

4

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

3

6

Peptide

KLIDSLEIK

Amino Acids from 5' Exons

DQNGFNPRILRQERPPHRSYRFSREGASGKVAEVLSGEFSICFGEAESWTDTTRASGRSPWQ,IKMVSIPEYYEGKNVLLTGATGFLGKVLLEKLLRSCPKVNSVYVLVRQKAGQTPQERVEEVLSGK,SKWFQSQNTMKARTSSSQELPVFGRCFWKSCGLVLRIQYMFWGRKLDRHHKSEWKKSLVA

Amino Acids from 3' Exons

RCCSVKCDCNATAYSPCTTNEESGSVHACINSICLLSQAYSSLSTTCGSQEADFFR,DAVQLNVIATRQLILLAQQMKNLEVFMHVSTAYAYCNRKHIDEVVYPPPVDPKKLIDSL,MLFSMLQRDSLFSLHNKRIWKCSCMYQQHMPTVIASILMKSIHHLWIPRSLIL