McDonnell Genome Institute

Washington University

CircRNA

chr11|134292131|134318747|+|GLB1L3|ENST00000498012.5

Cancer

Type of Peptide

PRAD

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9031

6

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

6

2

Peptide

KILDGLIR

Amino Acids from 5' Exons

ALLRRGIVELLLTSDGEKHVLSGHTKGGTHLELVHRRTGLSASPCKSTHCRENQVHLDTSLSRVHWDGSWSSMLQMRTQGGSGPLTAPYLGLAPAVFKHSSTGAPLFSGRLSISHSFSVARNLHWCCAWLGIRAISTNLGNHRENQKMGVVSGTPPRSGSIPGILPPKALCGHLGDPRELSGRKILDGLIRWQGTRPGVSRGAGRAAAGGCRSASLVVALPRKPGTLEHVLSLGPGSLCPVSSLIMSGSLGLAHFSAQSVVNFNSGCPRKCQGCGDGRGSPLDVAEWGPDSISPSSLLSMGSSCVRPGRGRIPSLPQHLSHASAGSLSSLCSVGRHQFAKTSPGYFQSASSP,PCEEGLWSFSPLMVRNMCVATPKEVHISFTGEQGSQPARVNLEHTAEKTKCISIPPFPVSTGMDPGVRCYNKGLKVKAQGHSQLPILALLLPSLNTAALELLCSQDAFPSPIVFLWQEICIGAAPGLGSGPSPLTWETTGRTRRWVLCQEPRLDPVPFLGSYRPRLCVDTEILENVAGRFWTDSSDGNSEGHAREAGERGELLPAAAVLPPWLFQGSLAHWNTCAWGQEACVPFPVSCQGALAWLTSLHRVWLISTVGVLASVRDVAMAVAALWMWQSGVQTASRHPHCAWVPPACVRAGGAFLPFPDSTCLMPQLGLSLLYAVLAAINLQKLHQDTFNQLHKVQ,PAEKRDCGASLDLWETCAEWPHQRRYTFRVSSQENRALSQPVILNTLQRKPSASRYLPFPCPLGWILEFDVTINEDSRLRLRATHSSLSWPCSCRLTQQHWSSSVLRTPFHLPFFCGKKSALVLRLAWDQGHLHLGKPQGEPEDGCCVRNPAIRFHSWDPTAQGSVWTLRRSRIKWQEDSGRTHQMAIVRDTPGSEQGSGASCCRRLPFCLLSSGSSKEAWHTGTRAELGARKPVSRFQSNHVREPWPGSLLCTECGFQQWVSSQVSGMWRWPWQPFGCGRVGSRQHLAILTAEHGFLLRASGPGAHSFPSLTALVSCLSWVSLFFMQCWPPSICKNFTRILSISFIKS

Amino Acids from 3' Exons

NWNYGFVFINGRNLGRYWNIGPQKTLYLPGVWLHPEDNE,TGIMDLCSSMDVTLGDIGILGLRKHCTFLEFGFIQKTM,LELWICVHQWTPWAILEYWASENTVPSWSLASSRRQ