McDonnell Genome Institute

Washington University

CircRNA

chr11|133919741|133927091|-|IGSF9B|ENST00000321016.12

Cancer

Type of Peptide

CCRC

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.995

12

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

5

2

Peptide

RLPLEGR

Amino Acids from 5' Exons

LVLWQGEPREHPHAPSAVRILRRPGPARGQEDAEPHPEGAVAVQEDQAGHQQQEVQRGQGRGRGRGHHAHRAHQQRPRPLRDGPCRDGALAEEQAHRGLPLRRGDGHVPRVPPVGRGERGPTGAHICGRPEVPAHPSVIQPGVLPATTSIQPSVPAPRAGGPRWPGRSASGHRPGPAPCPPALPPWPVLWVPQQQQPWGGGAAPVLRARSGQPPELRHVVPAPAHRGALWPPHHPRGEWRECIQQHAALDSDTYRRALPALGPARIPLRGAGDPSDDVPPPAATLCARESAAQGRPPPRTAPHLPAGARGLPGHPVSGGTEGLGRQVARQGPCPSAPRRQVAGQTYATSGKPRAAATYKPRHGHTCAALPRAGAGGARRPQHIWPGHPVVAPAPAPAPSAGQARRAQFTSSGATALPALTSDPKPPQLPHRLPARRPCPASPGPPAAGRDVRDHPAAAGCSQLFSKVYAVHRLPLPEQPQWESQLPARHGLHHSGHRLPFPSTRPRPCWAWGQLGRVWTDAFPSKDGGGIAPTGDPTTHVTYFR,LSSGKVSPESIRTLRAPSESSDDQGQPAAKRMLSPTREKELSLYKKTKRAISSKKYSVAKAEAEAEATTPIELISRGPDGRFVMDPAEMEPSLKSRRIEGFPFAEETDMYPEFRQSDEENEDPLVPTSVAALKSQLTPLSSSQESYLPPPAYSPRFQPRGLEGPGGLEGRLQATGQARPPAPRPFHHGQYYGYLSSSSPGEVEPPPFYVPEVGSPLSSVMSSPPLPTEGPFGHPTIPEENGENASNSTLPLTQTPTGGRSPEPWGRPEFPFGGLETPAMMFPHQLPPCDVPESLQPKAGLPRGLPPTSLQVPAAYPGILSLEAPKGWAGKSPGRGPVPAPPAAKWQDRPMQPLVSQGQLRHTSQGMGIPVLPYPEPAEPGAHGGPSTFGLDTRWYEPQPRPRPSPRQARRAEPSLHQVVLQPSRLSPLTQSPLSSRTGSPELAARARPRPGLLQQAEMSEITLQPPAAVSFSRKSTPSTGSPSQSSRSGSPSYRPAMGFTTLATGYPSPPPGPAPAGPGDSLDVFGQTPSPRRTGEELLRPETPPPTLPTS,CPLARAPRASARSERRQNPPTTRASPRPRGCAPPVRRSCRCTRRPSGPSAARSTAWPRQRPRQRPPRPSSSSAEALTAASWTLPRWSPRRAGASRASPSPRRRTCTPSSASRTRRTRTHWCPHLWPPSPSSPLCHPARSPTCHHQHTALGSSPAGWRAPVAWKVGFRPQARPGPLPPGPSTMASIMGTSAAAALGRWSRPRSTCQKWAAPAPSCRPRPCPPRGPLATPPSPRRMERMHPTARCPLRHLQEGAPLSPGAGQNSPSGGWRPQRCSPTSCHPVMCPRVCSPRPASPEDCPPPPCRCPRPTRASCLWRHRRVGQASRPAGALSQRPPPPSGRTDLCNLWAKGSCDIQAKAWAYLCCLTPSRLSRGRTAAPAHLAWTPGGMSPSPGPGLALGRPGAPSPVYIKWCYSPPGSHLPKAPSAPAPAPLSSPPVPGLARASCSRQRCQRSPCSRRLQSAFLESLRRPQAPPPRAAAVGVPATGPPWASPLWPPATLPLHPAPPLLGLGTAWTCLDRRLPLEGRGRNCSDRRPHHPRYLLQ

Amino Acids from 3' Exons

DEAGTVWAPLAVLASAARTQLAAGGHPGADSVPVQRPGPEQAGNQRLQGGHCEHF,MKRAQFGPHDWLSLPVPPGPSWLLVDTLEPETAYQFSVLAQNKLGTSAFSEVVTVNTL,SGHSLGPMTGCPCQCRQDPAGCWWTPWSLRQRTSSASWPRTSWEPAPSVRWSLTL