McDonnell Genome Institute

Washington University

CircRNA

chr11|1286001|1290409|-|TOLLIP|ENST00000263646.11

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9582

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

7

2

Peptide

LAMCPSQAK

Amino Acids from 5' Exons

LLPAAMVMPPQPVVLMPTVYQQGVGYVPIT,CFQLPWCHPSPWSCQQCTSRALAMCPSQ,ASSCHGDATPARGPDANSVPAGRWLCAHH

Amino Acids from 3' Exons

AKLAKNYGMTRMDPYCRLRLGYAVYETPTAHNGAKNPRWNKVIHCTVPPGVDSFYLEIFDE,QSWPRITAPAWTPTADCAWATRCTRRPRHTMAPRIPAGIRSSTARCPQAWTLSISRSSM,KVGQELRHDPHGPLLPTAPGLRGVRDAHGTQWRQESPLEGHPLHGAPRRGLFLSRDLR