McDonnell Genome Institute

Washington University

CircRNA

chr11|125460497|125489822|-|FEZ1|ENST00000278919.7

Cancer

Type of Peptide

PRAD

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9998

4

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

9

Peptide

VAVVLLLSK

Amino Acids from 5' Exons

VIEEIEEMMQNSPDPEEEEEVLEEEDGGETSSQADSVLLQEMQALTQTFNNNWSYE,LRRLRKCRTPQTLRKKRRFWKKRMEEKLPPRQTRSSCRRCRHHRPSTTTGPMK,NGDGNDAELPRPGRRGGSGRRGWRRNFLPGRLGPPAGDAGIDTDLQQQLVL

Amino Acids from 3' Exons

INSSKSLLFSCARMEAPLVSLDEEFEDLRPSCSEDPEEKPQCFYGSSPHHLEDPSLSELENFSSEIISFKSMEDLVNEFDEKLNVCFRNYNAKTENLAPVKNQLQIQEEEETLQDE,THPESRCCSPAEQEWRPHWVWMKSLRTFDPPARRTRRRSPSVSMVHLPTISRTPPSPSLRIFLPKSASSPWRTSMNLMRSSMSAFGTTTPRPRTLPRTSYRSKRRRRPFRTR,KLILKVAVVLLLSKNGGPTGESGRVGPSTLLLGGPGGEAPVFLWFISPPSRGPLPLRAEFFFRNNQLQVHGGPRKIEAQCLLSELQRQDREPSSREEPVTDPRGGGDPSGRG