McDonnell Genome Institute

Washington University

CircRNA

chr11|1252808|1255558|+|MUC5B|ENST00000529681.5

Cancer

Type of Peptide

OV

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9335

2

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

10

Peptide

LLSATTLCPR

Amino Acids from 5' Exons

VNETWTLENCTVARCVGDNRVVLLDPKPVANVTCVNKHLPIKVSDPSQPCDFHYECE,MRPGPWRTARWPGAWVTTVSSCWTQSLWPTSPATSTCPSKCRTRASPVTSTMSAS,EDLDPGELHGGQVRGQPCRPAGPKACGQRHLREQAPAHQSVGPEPALLPLVR

Amino Acids from 3' Exons

GLCVPQPCAPGPILQRLHQRPLQGPPGALPEPGGLRRALPRPGSVQLARCNRWPV,VFAECHNLVPPGPFFNACISDHCRGRLEVPCQSLEAYAELCRARGVCSDWRGATGGLC,SLLSATTLCPRAHSSTPASATTAGAALRCPARAWRLTQSSAAPGECAVTGEVQPVACA