McDonnell Genome Institute

Washington University

CircRNA

chr11|123058251|123058830|-|HSPA8|ENST00000227378.7

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9996

18

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

2

10

Peptide

NQVYEGERAMTK

Amino Acids from 5' Exons

AVARKTLNVWSRKLRSTKLKMRSRGTRCHPRIHLSPMPSTKQLLKMRNFKARLTMRTNRRFWTSVMKLSTGLIRI,PFEQGRHTYGPGSEVQSREAEGQGVIQEFTVLCLQHESNCRETSRQDRGQTEDSGQVNYQLAES,RLSKEDIERMVQEAEKYKAEDEKQRDKVSSKNSLESYAFNMKATVEDEKLQGKINDEDKQKILDKCNEIINWLDKNQ

Amino Acids from 3' Exons

VYEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSAVDKSTGKENKITITNDK,FMKASVPQRITTCLASLNSQAYLLHPEVFLRLKSLLTLMPMVYSMSLLWTRVREKRTRLLSLMTR,LRRACHDKGQPAWQVTHRHTSCTPRCSSDSHFHCQWYTQCLCCGQEYGKREQDYYHQ