McDonnell Genome Institute

Washington University

CircRNA

chr11|120476660|120481576|+|ARHGEF12|ENST00000356641.7

Cancer

Type of Peptide

BRCA-HER2-enriched

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.947

19

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

11

2

Peptide

LYSSFPCQTMALR

Amino Acids from 5' Exons

ITKLYSSFPCQTMALRFMNWWHRQFLKRL,QSFIRHFHVRQWRSDLTGGTDSFKDC,NKALFVISMSDNGAQIYELVAQTVSEKT

Amino Acids from 3' Exons

ETISLMAMTQCRRVPQMRRLLPHLPCSPQASLLWNPPTSSNILLRILTPMGQFHHSPPNFWSSSAGELWSIPVLRSRVPPLVQIHRARSWSTFIRRLTLNT,KLFDPWLPSAGEFHRGGCFLTYPAAHDRHPCCGIHPPAATFSSEYSLRWGNFTIHPRISGPAALGSYGVFLFDPESLLLCRFTEPDHGVHSDRGPTLK,NYLILDGYDPVQESSTDEEVASSLTLQPMTGIPAVESTHQQQHSPQNTHSDGAISPFTPEFLVQQRWGAMEYSCFEIQSPSSCADSQSQIMEYIHKIEADLEHLK