McDonnell Genome Institute

Washington University

CircRNA

chr11|120446402|120481576|+|ARHGEF12|ENST00000356641.7

Cancer

Type of Peptide

EOGC

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9536

2

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

5

3

Peptide

ICIATISK

Amino Acids from 5' Exons

KREDLSSFLRICIATISKLCKKESIQKFKGTKIF,KEKTAHSGSASPLYPNYARKSPSRSSKALRRFS,KRRPELIPEDLHRHYIQTMQERVHPEVQRHLEDF

Amino Acids from 3' Exons

ETISLMAMTQCRRVPQMRRLLPHLPCSPQASLLWNPPTSSNILLRILTPMGQFHHSPPNFWSSSAGELWSIPVLRSRVPPLVQIHRARSWSTFIRRLTLNT,KLFDPWLPSAGEFHRGGCFLTYPAAHDRHPCCGIHPPAATFSSEYSLRWGNFTIHPRISGPAALGSYGVFLFDPESLLLCRFTEPDHGVHSDRGPTLK,NYLILDGYDPVQESSTDEEVASSLTLQPMTGIPAVESTHQQQHSPQNTHSDGAISPFTPEFLVQQRWGAMEYSCFEIQSPSSCADSQSQIMEYIHKIEADLEHLK