McDonnell Genome Institute

Washington University

CircRNA

chr11|120442103|120480430|+|ARHGEF12|ENST00000356641.7

Cancer

Type of Peptide

EOGC

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9548

39

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

13

Peptide

LMTVESTFLMPVK

Amino Acids from 5' Exons

LCYLYSDLYKHTNSKETRRIFLEFHQFFLDRSA,SVISIQTCINIPIPKKLVASSLSFISSFIDQ,LLSLFRPVTYQFQRNSSHLPVSSVLSRSIS

Amino Acids from 3' Exons

WVCSSCWCNSVLRRAFRKTGNISQDTEQPLRGRRQTVSSRTLKILRPIILVKDICPLELELVTLQLVTVHGLQLNLLLHGIQWDWHPRIARQVTFWTTLPQRCLPWSQKGVLMTVESTFLMPVKHIVMRIHQKVMEQLTRKRRMLIYASQ,GFVEAVAGATARFDEERSGRLATFPKIQNSLSGAADRQCHPELKYGLSFWRTYALNWNWHCNLLQSTDFNIFCSTGFSGTGTPGPGKHFSNGPHDYDPRDAYHGARRGSQWRALFCPSTESIRRWSSQGREGCFTHL,GLLKQLLVQQLGLTEKSVQEDWQHFPRYRTASQGPQTDSVIQNSENIKAYHSGEGHMPFRTGTGDIATCYSPRTSTESFAPRDSVGLAPQDSQASNILVMDHMIMTPEMPTMEPEGGLDDSGEHFFDAREAHSDENPSEGDGAVNKEEKDVNLRIS