McDonnell Genome Institute

Washington University

CircRNA

chr11|11920155|11952871|+|USP47|ENST00000339865.9

Cancer

Type of Peptide

HCC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

1

2

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

22

3

Peptide

EKEEALHAFIQPEILDGPNQYFCER

Amino Acids from 5' Exons

EEALHAFIQPEILDGPNQYFCERCKKKCDARK,KKHCMHLFSQRFWMAQISIFVNVVRRSVMHG,RSIACIYSARDSGWPKSVFLTLEEVCTE

Amino Acids from 3' Exons

GRRSPCHSLQFCQDGGSLQRSWIPSRRLYWKAVVWTNCER,GREDEVHVTACSFVKTVEAFRDEVGSLPGGCIGKQCGRIARE,VEKMKSMSQLAVLSRRWKPSEMKLDPFQEVVLESSSVDELREK