McDonnell Genome Institute

Washington University

CircRNA

chr11|11920155|11936510|+|USP47|ENST00000339865.9

Cancer

Type of Peptide

BRCA-Luminal B

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9941

3

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

7

2

Peptide

SIACIYSAR

Amino Acids from 5' Exons

EEALHAFIQPEILDGPNQYFCERCKKKCDARK,KKHCMHLFSQRFWMAQISIFVNVVRRSVMHG,RSIACIYSARDSGWPKSVFLTLEEVCTE

Amino Acids from 3' Exons

MMDLEEVIPLDCCRLVKYDEFHDYLERSYEGEEDTPMGLLLGGVKSTYMFDLLLETRKPDQVFQSYKPG,WIKRYPWIAVALLNMMSFMIINGHMKEKKIHQWGFYVASSQHICLICCWRRESLIRFSNLINLE,DGFRRGNTPGLLSPCIVSLSRTVIRRRRYTNGASTRWRQVNIYVSAVGDEKASGFPILTW