McDonnell Genome Institute

Washington University

CircRNA

chr11|119158556|119158725|+|ABCG4|ENST00000615496.4

Cancer

Type of Peptide

BRCA-Luminal B

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9948

5

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

18

Peptide

LACSSASSTCILATMPAR

Amino Acids from 5' Exons

VLTHLRFMSHVVIGVLIGLLYLHIGDDASKVFNNTGCLFFSMLFLMFAALMPTVLT,SPTYGSCPTWLLACSSASSTCILATMPARSSTTPAASSSPCCSSCSPPSCQLCSP,PDPPTVHVPRGYWRAHRPPLPAYWRRCQQGLQQHRLPLLLHAVPHVRRPHANCAH

Amino Acids from 3' Exons

VLTHLRFMSHVVIGVLIGLLYLHIGDDASKVFNNTGCLFFSMLFLMFAALMPTVLT,SPTYGSCPTWLLACSSASSTCILATMPARSSTTPAASSSPCCSSCSPPSCQLCSP,PDPPTVHVPRGYWRAHRPPLPAYWRRCQQGLQQHRLPLLLHAVPHVRRPHANCAH