McDonnell Genome Institute

Washington University

CircRNA

chr11|119088634|119089131|+|HMBS|ENST00000542044.5

Cancer

Type of Peptide

BRCA-Luminal A

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9654

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

8

Peptide

LMGSPVPR

Amino Acids from 5' Exons

LARIQTDSVVATLKASYPGLQFEISEFSGKEWKLMGSPVPREERTQHFWLCLLKPVPLPRDSFWAAPSSEGAFLIPPALTTWISLAFNILSFGSFYECFWSSCSIVYTQRAGTRDYVPLSPSIVAQRAQMLINNEHLIDLSPQLLCPPQGTRFLILHSL,LLAYRRTVWWQHKPRTLACSLKSVSFLERSGSWEAQYPERREHNISGFAYSSPSRCPEIPSGLLPVLKVLSSEYLQLLPGLAWHLTSALGLFMSVSGLPARLYILRGQEPGIMCLCPHHESHSARLSKCSIMSTLIDSLLSCYVHHRGQDSYCTL,CSHTDGQCGGNIESLVPWPAVNQVFWKGVEANGKPSTPRGENTTFLALPIAKARPAAPRFLLGCSQFRCFPLNTSSSDYLDPGIHLELWVFLVFLVFLLDCIYSEGRNQGLCASVPIMNRSTALGSVNADQAPDLTLSSVAMSTTGDKILDTALSK

Amino Acids from 3' Exons

LARIQTDSVVATLKASYPGLQFEISEFSGKEWKLMGSPVPREERTQHFWLCLLKPVPLPRDSFWAAPSSEGAFLIPPALTTWISLAFNILSFGSFYECFWSSCSIVYTQRAGTRDYVPLSPSIVAQRAQMLINNEHLIDLSPQLLCPPQGTRFLILHSL,LLAYRRTVWWQHKPRTLACSLKSVSFLERSGSWEAQYPERREHNISGFAYSSPSRCPEIPSGLLPVLKVLSSEYLQLLPGLAWHLTSALGLFMSVSGLPARLYILRGQEPGIMCLCPHHESHSARLSKCSIMSTLIDSLLSCYVHHRGQDSYCTL,CSHTDGQCGGNIESLVPWPAVNQVFWKGVEANGKPSTPRGENTTFLALPIAKARPAAPRFLLGCSQFRCFPLNTSSSDYLDPGIHLELWVFLVFLVFLLDCIYSEGRNQGLCASVPIMNRSTALGSVNADQAPDLTLSSVAMSTTGDKILDTALSK