McDonnell Genome Institute

Washington University

CircRNA

chr11|119070233|119071843|+|VPS11|ENST00000614944.4

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9704

19

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

11

3

Peptide

FLPSFTDGSVTLNK

Amino Acids from 5' Exons

VSQMAVLHTKETSPGTGIARPRFCTRATILLDWPFAKQERPLTCLLQQRTS,FHRWQCYIEQRRHHPGPAQDPDFAQGQLSCNWIGLSPSRKDHSLVCCDNRERP,FTDGSVTLNKGDITRDRHSKTQILHKGNYPVTGLAFRQAGKTTHLFVVTTENVQ

Amino Acids from 3' Exons

SYIVSGKDYPRVELDTHGCGLRCSALSDPSQDLQFIVAGDECVYLYQPDERGPCFAFEGHKLIAHWFRGYLIIVSRDRKVSP,PIFLEKTTLAWSWTPMVVACAAQPVTLLRTCSSLWPGMSVSTCTSLMNVGPASPLRAISSLPTGLEATLSLSPVTGRFLP,LYSFWKRLPSRGVGHPWLWPALLSPKPFSGPAVHCGRGVCLLVPATWALLRLGPAHCPLVRLPYHCLPPEGFSQ