McDonnell Genome Institute

Washington University

CircRNA

chr11|118634922|118639251|+|PHLDB1|ENST00000534140.2

Cancer

Type of Peptide

EOGC

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9999

3

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

7

1

Peptide

EQLQEQLR

Amino Acids from 5' Exons

ERAELAAGRRHLEARQALYAELQTQLDNCPESVREQLQEQLRR,RGRSWPRDGGTWRPARRSTPSSRRSSITAPSQCGNSYRSSE,EGGAGRGTEAPGGPPGALRRAPDAARLPRVSAGTVTGAAEK

Amino Acids from 3' Exons

EKEKLTVLERRYHSLTGGRPFPKTTSTLKE,RRRSLCWKGDTTHSQGAGLSRRPHRPSK,EGEADCAGKEIPLTHRGQAFPEDHIDPQR