McDonnell Genome Institute

Washington University

CircRNA

chr11|118481714|118501857|+|KMT2A|ENST00000389506.9

Cancer

Type of Peptide

HCC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9404

21

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

3

4

Peptide

LPSAAVK

Amino Acids from 5' Exons

LKRKRKSLRPVKRKTAKRAVLRTWWTLVRNLPHQQERILPQRKAVVSLLHESPSRKRVKKGMSRPLGLNPNRPPLQLPGSQASRSPSQHWSSRLSHLLQDRQEKKFPKPLLVSPRKSSLHHQNQ,CEKEREKVDQKERQQREQCCEERGGLSETYPISKRGSCPKEKQASSTKARRGKERRECLGPWAIQTGHHSSFQEVKQAGLPASTGHPASATYYRTAKKRSSQNHSAQEKAASTTRI,VKKKEKKSKTSEKKDSKESSVVKNVVDSSQKPTPSAREDPAPKKSSSEPPPRKPVEEKSEEGNVSAPGPESKQATTPASRKSSKQVSQPALVIPPQPPTTGPPRKEVPKTTPSEPKKKQPPPPES

Amino Acids from 3' Exons

KVHQKRVKTQLKLVLHHQTDLLIHKPLAPVIIMSSQRSPGFEHPVILQHRDPLAVDRCLLQ,KFIKRESKHSNYKSSITRPTSSFTNLWLLLLSCHLKGPQDSNTQLFSNTEIPWLSTVAFC,SSSKESQNTAEIISPPSPDRPPHSQTSGSCYYHVISKVPRIRTPSYSPTQRSPGCRPLPSA