McDonnell Genome Institute

Washington University

CircRNA

chr11|118477966|118499420|+|KMT2A|ENST00000389506.9

Cancer

Type of Peptide

PRAD

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9554

4

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

2

14

Peptide

FLNGLEPENIHMMIDK

Amino Acids from 5' Exons

TSHQLLAQKMLNLLLHPSNQLNLSLETRHPRNLQRKDVDRGGVGSVPAARCLRTVVFVLIAISPSLVVAIRSSAA,QVINCWLRRCTSCSTHQTNTCHKQGTPGTSSKERTSIEAVWAVSRLPGAGLWCLYLLRAQVWWSQYKEAVLQ,KSSIAGSEDAEPLAPPIKPIKPVTRNKAPQEPPVKKGRRSRRCGQCPGCQVPEDCGVCTNCLDKPKFGGRNIKKQCC

Amino Acids from 3' Exons

VVPENGFEVFRRVFVDFEGISLRRKFLNGLEPENIHMMI,WFLRMDLKFSEECLWTLKESAEGSFSMAWNQKISTL,GSEWISFQKSVCGLRNQLEKEVSQWLGTRKYPHDD