McDonnell Genome Institute

Washington University

CircRNA

chr11|11372514|11379264|-|GALNT18|ENST00000227756.4

Cancer

Type of Peptide

BRCA-Luminal B

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9962

4

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

8

3

Peptide

ECGAWDQEELK

Amino Acids from 5' Exons

EPCPHWLLHCGPAVLPGDRPAGRRHGSLRGRECGAWDQ,SPALIGCFIVDRQYFQEIGLLDEGMEVYGGENVELGIR,ALPSLAASLWTGSTSRRSACWTKAWKSTGARMWSLGS

Amino Acids from 3' Exons

RNRRSPNMWTRTARSQASSKSCVTASRKASSAPGSVAGGRPLPLWWHSLMPTWSSMWA,GTEGEADRICGQGEQPEARLHQSRASQQAGRPHPLQGQWLEGGHCPCGGTLCPRGVQCGL,ELKEKLTEYVDKVNSQKPGFIKVVRHSKQEGLIRSRVSGWRAATAPVVALFDAHVEFNVG