McDonnell Genome Institute

Washington University

CircRNA

chr11|113272932|113273748|+|NCAM1|ENST00000528158.2

Cancer

Type of Peptide

OV

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9944

5

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

8

Peptide

TPDIDLAK

Amino Acids from 5' Exons

AACRHYGHCRGHAAFCHHRHHLHYHRNLCHCSEQPHQDHHPDLQYCPAGHGHALKLCTGWPGHPFQGAQRLCPLPGPSFSPQGRPPRPERHPDLNPCRQFVFCPGPRGCPQPKRPCWCRGGLGSSGQQAHPCTSPHPDWGSQSSSSSGCPCHRSPSGQAGGSQHQRPGPGAHPARSREEPGRGSHSPCPEERGCLRQHHKPFPGRGLNGRRELQDPRYPCKGCFCSPGLSCSRRWGQWTSPACSFHCRQLCFACASKDR,LPADTTATVEDMLPSVTTVTTNSDTITETFATAQNSPTSETTTLTSSIAPPATATPDSNSVPAGQATPSKGPSASAPSPAPASAPKVAPLVDLSDTPTSTPAASNLSSSVLANQGAVLSPSAPAGVGEASKAPPASKPTPAPVPTPTGAASPLAAAAAPATEAPQAKQEAPSTKGPDPEPTQPGAAKSPAEAATALASPKSEAASVSTTNPSQGEDFKMDEGNFKTPDIDLAKDVFAALGSPAPAAGASGQAPELAPSTADSSVSPAPAKT,CLPTLRPLSRTCCLLSPPSPLTLTLSPKPLPLLRTAPPVRPPPPPVLPRRPRPRLTQTLYRLARPPLPRGPAPLPPPRPQLQPPRSPPSLTATPRPQPLPLAICLLVSWLTKGLSSAQAPLLVSGRPLRLLRPASPPLHQSPPRLGQPVLQQRLPLPQKPLRPSRRLPAPKARTRSPPSPEPRRARPRQPQPLLARRARLPPSAPQTLPRARTLKWTKGTSRPQILTLQRMFLQPWALLLPPLGPVDKPLSLLLPLQTALFRLRQQRP

Amino Acids from 3' Exons

AACRHYGHCRGHAAFCHHRHHLHYHRNLCHCSEQPHQDHHPDLQYCPAGHGHALKLCTGWPGHPFQGAQRLCPLPGPSFSPQGRPPRPERHPDLNPCRQFVFCPGPRGCPQPKRPCWCRGGLGSSGQQAHPCTSPHPDWGSQSSSSSGCPCHRSPSGQAGGSQHQRPGPGAHPARSREEPGRGSHSPCPEERGCLRQHHKPFPGRGLNGRRELQDPRYPCKGCFCSPGLSCSRRWGQWTSPACSFHCRQLCFACASKDR,LPADTTATVEDMLPSVTTVTTNSDTITETFATAQNSPTSETTTLTSSIAPPATATPDSNSVPAGQATPSKGPSASAPSPAPASAPKVAPLVDLSDTPTSTPAASNLSSSVLANQGAVLSPSAPAGVGEASKAPPASKPTPAPVPTPTGAASPLAAAAAPATEAPQAKQEAPSTKGPDPEPTQPGAAKSPAEAATALASPKSEAASVSTTNPSQGEDFKMDEGNFKTPDIDLAKDVFAALGSPAPAAGASGQAPELAPSTADSSVSPAPAKT,CLPTLRPLSRTCCLLSPPSPLTLTLSPKPLPLLRTAPPVRPPPPPVLPRRPRPRLTQTLYRLARPPLPRGPAPLPPPRPQLQPPRSPPSLTATPRPQPLPLAICLLVSWLTKGLSSAQAPLLVSGRPLRLLRPASPPLHQSPPRLGQPVLQQRLPLPQKPLRPSRRLPAPKARTRSPPSPEPRRARPRQPQPLLARRARLPPSAPQTLPRARTLKWTKGTSRPQILTLQRMFLQPWALLLPPLGPVDKPLSLLLPLQTALFRLRQQRP