McDonnell Genome Institute

Washington University

CircRNA

chr11|113231644|113256001|+|NCAM1|ENST00000316851.11

Cancer

Type of Peptide

OV

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9423

2

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

9

3

Peptide

YRATLDGHMVVR

Amino Acids from 5' Exons

TLDGHMVVRSHARVSSLTLKSIQYTDAGEYICTASNTIGQDSQSMYLEVQ,LWMGTWWCVAMPVCRRPRASSTLMPESTSAPPATPSARTPSPCTLKCN,SGWAHGGAPCPCVVADPEEHPVHCRRVHLHRQQHHRPGLPVHVPSA

Amino Acids from 3' Exons

GNPVHLSSKGRWERMETLLKTSSRMTAAPPSDTIWSGTE,GTQCTARRADGRGWKLYSEPDQAGRRLPHQTLSGQVPS,EPSAPKLEGQMGEDGNSIKVNLIKQDDGGSPIRHYLVRYRA