McDonnell Genome Institute

Washington University

CircRNA

chr11|111836164|111868736|-|ALG9|ENST00000398006.6

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9209

2

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

1

22

Peptide

YTHYLIYGEGFQTWEYSPAYAIR

Amino Acids from 5' Exons

LAASVHSIRVQRSVTKTFCRRTSGHPDCSYHEPESRRAIQI,WQLQFIPSEFRGQLPKPFAEGPLATRIVPTDMNDQNLEEPSRY,GSFSSFHQSSEVSYQNLLQKDLWPPGLFLLTMTRIKSHPD

Amino Acids from 3' Exons

THYLIYGEGFQTWEYSPAYAIRSYAYLLLHAWPAAFHARILQTNK,HTTSSMGKGFRLGNIPQHMPFAPMLTCCFMPGQLHFMQEFYKLI,TLPHLWGRVSDLGIFPSICHSLLCLPVASCLASCISCKNSTN