McDonnell Genome Institute

Washington University

CircRNA

chr11|110233236|110247833|-|RDX|ENST00000343115.8

Cancer

Type of Peptide

BRCA-Luminal B

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9365

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

4

5

Peptide

KQLQGTIRE

Amino Acids from 5' Exons

AFAAQEDLEKTKEELKTVMSAPPPPPPPPVIPPTENEHDEHDENNAEASAELSNEGVMNHRSEEERVTETQKNERVKKQLQ,LLQPRKTWKRPKKSKLCLPPLHLHHHQSFLQQKTNMMNTMRIMLKLVLNYQMKGTIEARKNVPKHRKMSVLRSNF,FCSPGRLGKDQRRVKNCDVCPPSTSTTTSHSSNRKRTTRECSCIIKRGNEPKRGRTCNRNTEKACEATS

Amino Acids from 3' Exons

GTIREKEEKRNSRKGKGKNRTKGRANGTSKTNRADNSSE,AQLENEKKKREIAEKEKERIEREKEELMERLKQIEEQTIKAQK,HNRMKRRKEKQKRKRKENVKRKSWNVNKLKSRQLKLRK