McDonnell Genome Institute

Washington University

CircRNA

chr11|108486156|108486440|-|KDELC2|ENST00000323468.9

Cancer

Type of Peptide

OV

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.944

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

11

Peptide

DQCTMSTVSVR

Amino Acids from 5' Exons

DQCTMSTVSVRKILRPGRRLFLVQPRNHRLQKILLPFPASISSKCKKSPKGLGMREVPLFITRFSITMFTGDLGNTQTSRCSLMRFCYHQE,TSVPVLVSGRSSGLAEDSFLSNQGTTDCKRFCFLSQHQSPANAKRSPQKVWGERCHCSLHDSQPCLPEIFREIHRLQDVLDFVIIDKK,PVYHEYCECPEDPQAWQKTLSCPTKEPQIAKDFASFPSINLQQMLKEVPKRFGDERGAIVHYTILNNHVYRRSLGKYTDFKMFSDEILLSLTRK

Amino Acids from 3' Exons

DQCTMSTVSVRKILRPGRRLFLVQPRNHRLQKILLPFPASISSKCKKSPKGLGMREVPLFITRFSITMFTGDLGNTQTSRCSLMRFCYHQE,TSVPVLVSGRSSGLAEDSFLSNQGTTDCKRFCFLSQHQSPANAKRSPQKVWGERCHCSLHDSQPCLPEIFREIHRLQDVLDFVIIDKK,PVYHEYCECPEDPQAWQKTLSCPTKEPQIAKDFASFPSINLQQMLKEVPKRFGDERGAIVHYTILNNHVYRRSLGKYTDFKMFSDEILLSLTRK