McDonnell Genome Institute

Washington University

CircRNA

chr11|108271063|108304852|+|ATM|ENST00000278616.8

Cancer

Type of Peptide

HCC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.999

9

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

4

3

Peptide

VPLANGR

Amino Acids from 5' Exons

YLMLLKELPGEEYPLPMEDVLELLKPL,ICFRSFLEKSTPCQWKMFLNFNHY,SNAFKGASWRRVPLANGRCSTSETTI

Amino Acids from 3' Exons

VKTDFCQTVLPYLIHDILLQDTNESWRNLLSTHVQGFFTSCLRHFSQTSRSTTPANLDS,KLTFVRLYFHTFMIFYSKIQMNHGEICFLHMFRDFSPAVFDTSRKRADPQPLQTWIQ,ENLLSDCTSILDSYFTPRYKIMEKSAFYTCSGIFHQLSSTLLANEPIHNPCKLGF