McDonnell Genome Institute

Washington University

CircRNA

chr11|108073389|108095691|+|CUL5|ENST00000393094.6

Cancer

Type of Peptide

CCRC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9466

9

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

4

4

Peptide

RTLWDSEK

Amino Acids from 5' Exons

DSEKYVEQLLTLFNRFSKLVKEAFQDDPRFLTARDK,TLRNTLSSYLHYLIDLVNSSKKLFKMIHDFLLQEI,LEIRAVTYTIITRQRSFSRSTISYCKR

Amino Acids from 3' Exons

ITFKNEVGQYDLEVTTFQLAVLFAWNQRPREKISFENLKLATELPDAELRRTLW,HLRMKLVNMIWRPRFSSLYCLHGTKDPERKSALKILSLQLNSLMLNLGGLY,NIESWSIFGGNHVSARCIVCMEPKTQRENQLKSACNTPCTEDFM