McDonnell Genome Institute

Washington University

CircRNA

chr11|107635635|107656066|+|ELMOD1|ENST00000265840.11

Cancer

Type of Peptide

OV

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9952

11

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

10

2

Peptide

SLGTGTLLQMWK

Amino Acids from 5' Exons

AGNLSSGLPSANRWVQEPYCRCGKTARGLFSPTRNAFE,LGISLQACLLQIVGYRNLIADVEKLRREAYDSDNPQHEEMLLK,WESLFRLAFCKSLGTGTLLQMWKNCVERPMILIIPNMKKCF

Amino Acids from 3' Exons

VLICNCGHQYNPGISTGQRSSKNPFLQYRPRSSNIVSLSANI,YSFAIVGINITDLAYNLLVSGALKTHFYNIAPEAPTLSHFQQTF,THLQLWASILTWHIIYWSAELKPISTISPQKLQHCLTFSKHS