McDonnell Genome Institute

Washington University

CircRNA

chr11|10755677|10768491|+|CTR9|ENST00000361367.6

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9408

5

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

6

8

Peptide

QYISAVQMNHLLGR

Amino Acids from 5' Exons

NHLLGRACFCLLEGDKMDQADAQFHFVLNQSPNNIPALL,TICWEEPASAYLRVTKWIKLMHSFILYSISLQIIFQPFL,PFVGKSLLLPTGQNGSSCTVSFCTQSVSKYSSPS

Amino Acids from 3' Exons

ELFWPTKDIFVKLVMYLPKEKQQQILVMCGTHTSMWSKSSTSAPFR,SCFGPQRIFSSSCICPSKRSNSRYCVAELSTHLCGAKAVHQRRSD,AVLAHKGYFREARDVFAQVREATADISDVWLNLAHIYVEQKQYISAVQM