McDonnell Genome Institute

Washington University

CircRNA

chr11|107329917|107353736|-|CWF19L2|ENST00000282251.9

Cancer

Type of Peptide

OV

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9995

3

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

13

2

Peptide

LWILAFTEGLPMSLK

Amino Acids from 5' Exons

VPRGLPYFSVDFGLHGGFAHVIEDQHKFPHYFGK,YPEGYLTSLWILAFTEGLPMSLKISTNSLITLE,TQRVTLLLCGFWPSRRVCPCHRSAQIPSLLWK

Amino Acids from 3' Exons

FMGKTDGDYYTLDDMFVSKAAERERLGEEEENQRKKAIAEHRSLAAQMEKCLYCFDSSQFPKHLIVAIGVK,LWEKQMETITPWMTCLSPKQLRENVLVKRKRTKGKKLLLSIGVLLHKWKNVCIVLTALNFPSILLLQVL,YGKNRWRLLHPGHVCLQSSERTSWRGREPKEKSYCASESCCTNGKMSVLFQLSISQASYCCNRC