McDonnell Genome Institute

Washington University

CircRNA

chr11|106708511|106940178|-|GUCY1A2|ENST00000282249.6

Cancer

Type of Peptide

LUAD

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9538

10

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

14

3

Peptide

EVTLGASMSAQPLTSLK

Amino Acids from 5' Exons

MRIGIHSGSVLAGVVGVRMPRYCLFGNNVTLASKFESGSHPRRINVSPTTY,GEFTQAPCWLELLGCECHVIACLEIMSHWQANSSREVTLGASMSAQPLT,EDRNSLRLRAGWSCWGANATLLPVWKCHTGKQIRVGKSPSAHQCQPNHLP

Amino Acids from 3' Exons

VSLRKFKKDLVKSSLIYAFMRMRESFELVALCRTFLTALMLCWNTLELLLENRPLWSHHLSYAKSSLKVLSCSTTSTLTILWGLQCWGLRLQERRSIGWMWKWNRLQMRSYALMFQTQAIVAVLLSLSKNVKILISRTFHREPPKFLRTSELASTPSVEPSLSTCLIPACQSFSWGKVGSSFDVTLTKCSSLRTASRLYLQRLMPPLKGSCCDCLPRLLEPSLRLLALKIKT,FEVGNSKKIWRVLYMLSEESPSSCRWHFAGLFRLCFVGTHNFFWKTGHSGVTIFPMQRAPRYSHAPLLPPSPYCGVCNAGDDGCRKEDLSAGCGSGTGCKEAMLCFKPRQLLSYFPYQRMKYYHEEPSTGNLPSSCGPQNHQHLLSLPFPLDVSQHVSPSVGGRSKEAASMHSQSAQVGLLRDCISKGCHLKGPAATVYPVCDNQAGFWLKRQ,LKFEEIQKRFGEEFFNICFHENERVLRAVGGTLQDFFNGFDALLEHIRTSFGKQATLESPSFLCKELPEGTLMLHYFHPHHIVGFAMLGMIKAAGKKIYRLDVEVEQVANEKLCSDVSNPGNCSCLTFLIKECENTNIMKNLPQGTSQVPADLRISINTFCRAFPFHLMFDPSMSVLQLGEGLRKQLRCDTHKVLKFEDCFEIVSPKVNATFERVLLRLSTPFVIRTKPEASGSENKDK