McDonnell Genome Institute

Washington University

CircRNA

chr11|10484819|10496938|+|AMPD3|ENST00000396553.6

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9894

8

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

8

2

Peptide

YTSTLLHCPR

Amino Acids from 5' Exons

TSTLLHCPRKTPTAWMMHPPTWITWSTCRGASSLCMITRRCWSTRSRTAYPTPTWRPTRWTATSWLSSPMAP,LPPSSTAPGRPLLPGCTPQPGLLGPHAGGHPLCVQEDAGAPGAAQPTLPRPGDLHGGHEPHPGSHHRWPH,FHPPPLPQEDPYCLDDAPPNLDYLVHMQGGILFVYDNKKMLEHQEPHSLPYPDLETYTVDMSHILALITDGP

Amino Acids from 3' Exons

HIVKEAAAKLWEDAGEHLPAPFQGHYQPPRSSRASPLPI,DIFRSKKLLPNFGKMLENIFLPLFKATINPQDHRELHLFLKY,TYLGQRSCCQTLGRCWRTSSCPFSRPLSTPKIIESFTSSLN